PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB10G25660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 323aa    MW: 35166.4 Da    PI: 8.0796
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB10G25660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.9e-19158212256
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL+ rqV vWFqNrRa+ k
  OB10G25660.1 158 RKKLRLSKDQAAVLEDTFKEHNTLNPKQKAALARQLGLKPRQVEVWFQNRRARTK 212
                   788899***********************************************98 PP

2HD-ZIP_I/II124.64.6e-40158242185
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                   +kk+rlsk+q+++LE++F+e+++L+p++K++lar+Lgl+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+een+rL+ke +
  OB10G25660.1 158 RKKLRLSKDQAAVLEDTFKEHNTLNPKQKAALARQLGLKPRQVEVWFQNRRARTKLKQTEVDCELLKRCCETLTEENRRLHKELA 242
                   69*******************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046189.6E-3220135IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.4E-19143208IPR009057Homeodomain-like
SuperFamilySSF466891.11E-18148215IPR009057Homeodomain-like
PROSITE profilePS5007117.362154214IPR001356Homeobox domain
SMARTSM003892.6E-17156218IPR001356Homeobox domain
CDDcd000862.35E-16158215No hitNo description
PfamPF000467.7E-17158212IPR001356Homeobox domain
PRINTSPR000317.0E-6185194IPR000047Helix-turn-helix motif
PROSITE patternPS000270189212IPR017970Homeobox, conserved site
PRINTSPR000317.0E-6194210IPR000047Helix-turn-helix motif
SMARTSM003404.8E-14214257IPR003106Leucine zipper, homeobox-associated
PfamPF021832.1E-8214242IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
METMVHGRRE QQRHVGLGLG LGLGLSLGVG AVDEQPCRGA RVPSPAAPPP PSQECSWSGA  60
GLFSSSSSDR RSTTMMTAMA ACHDVEMPFL RGIDVNRAPA ETTRPGLSCS EEDEETGASS  120
PNSTLSSLSG KRGAPAAART AAAGGSDDED SGAGAGSRKK LRLSKDQAAV LEDTFKEHNT  180
LNPKQKAALA RQLGLKPRQV EVWFQNRRAR TKLKQTEVDC ELLKRCCETL TEENRRLHKE  240
LAXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XPRQHPPRPA  300
DVVPPQAGGE EAAAVVEVLH WRG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1156162SRKKLRL
2206214RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0654041e-159AK065404.1 Oryza sativa Japonica Group cDNA clone:J013006I17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006662603.11e-173PREDICTED: homeobox-leucine zipper protein HOX1-like
SwissprotQ406918e-85HOX1_ORYSI; Homeobox-leucine zipper protein HOX1
SwissprotQ7XC548e-85HOX1_ORYSJ; Homeobox-leucine zipper protein HOX1
TrEMBLJ3N4W81e-145J3N4W8_ORYBR; Uncharacterized protein
STRINGOB10G25660.11e-144(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.16e-45homeobox from Arabidopsis thaliana